PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.006G078000.1
Common NamePHAVU_006G078000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family M-type_MADS
Protein Properties Length: 230aa    MW: 26004.6 Da    PI: 6.9271
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.006G078000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF52.46.5e-171052244
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                        +i n+s r+ +f+kR++ +lKK eE+S+LC++e++ i++++ g
  Phvul.006G078000.1 10 FIANNSDRKASFIKRKKSLLKKTEEISTLCGVEACTIVYGPYG 52
                        799*************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.3E-18160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.568152IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-8323IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-20385IPR002100Transcription factor, MADS-box
CDDcd002667.05E-22382No hitNo description
PfamPF003192.0E-141052IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-82338IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-83859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MSRRKVQLTF IANNSDRKAS FIKRKKSLLK KTEEISTLCG VEACTIVYGP YGPEPDVWIS  60
KSGVQNVVER FRNTCEHNKK MATQESFLSE RIAKGREKMK KHVRSNQEKE MNMFMFQCLK  120
NGRVELHNNM TTDDLNALSS VIENKLRDIN KRMETVNVTE MPPNQPQMEL AAVAVAAAPE  180
DITPPNHGDG TYMNANDPLQ SQWFMELLND DGDDETIKPS FGDPNLPPL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007146878.11e-173hypothetical protein PHAVU_006G078000g
TrEMBLV7BLP31e-173V7BLP3_PHAVU; Uncharacterized protein
STRINGGLYMA18G05990.25e-80(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1823856
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.12e-41AGAMOUS-like 80